PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1770_p4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LFY
Protein Properties Length: 413aa    MW: 46066.5 Da    PI: 6.9505
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1770_p4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY6121.1e-18613931386
     FLO_LFY   1 mdpeafsaslfkwdpraaa....aapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslse 95 
                 mdpe f++ lf+w+p  a+    +++p   ++   ++++p++ ++aa  ++l +le lf  yGvr++t+akiaelGft+stLv+mkdeel+d+m+sls+
  RrC1770_p4   1 MDPEGFTSGLFRWNPTRAMvqqqQQQPPP-VPPPPQQQPPATPQTAAFGMRLGGLEGLFGPYGVRFYTAAKIAELGFTASTLVGMKDEELEDMMNSLSH 98 
                 9*************665552332111222.23333344444556666666777********************************************** PP

     FLO_LFY  96 ifrldllvGeryGikaavraerrrlee..eeaekkrrkll.....sedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseeekkk 187
                 if+++llvGeryGikaavraerrrl+e  ee++++rr+ll      + +++aldalsqegls+epvq++ ++ ++g +g g+ +   a +   +++kk+
  RrC1770_p4  99 IFHWELLVGERYGIKAAVRAERRRLQEeeEEESSRRRHLLlsaagDSGTHHALDALSQEGLSDEPVQHRDQTDAAGINGGGRGGYWEAGQ---TSTKKQ 194
                 *************************99544456778887778844344556***************996665555444434444444442...233333 PP

     FLO_LFY 188 askkkqkrkkkkelkse.ededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqv 285
                 + ++++k+   ++++++ + ++ ++++  d++++++ g+erqrehPfivtepgevargkknGLDYLf+LyeqCrefLlqvq+iak+rGekcPtkvtnqv
  RrC1770_p4 195 Q-HRRRKKAIATSVETDdDGNEGDDDDGMDNSNGSALGTERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLLQVQTIAKDRGEKCPTKVTNQV 292
                 3.2233333333322221333445555566777888899************************************************************ PP

     FLO_LFY 286 fryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlersk 384
                 fryakk+ga+yinkPkmrhYvhCYalhcLdeeasnalr+afke genvG+wrqacykplv+ia r++wdidavfnahprLsiWYvPtkLrqLChler++
  RrC1770_p4 293 FRYAKKSGANYINKPKMRHYVHCYALHCLDEEASNALRKAFKEHGENVGSWRQACYKPLVDIACRHAWDIDAVFNAHPRLSIWYVPTKLRQLCHLERNN 391
                 **************************************************************************************************9 PP

     FLO_LFY 385 as 386
                 a+
  RrC1770_p4 392 AA 393
                 86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.1E-1961393IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPTRAMV QQQQQQPPPV PPPPQQQPPA TPQTAAFGMR LGGLEGLFGP  60
YGVRFYTAAK IAELGFTAST LVGMKDEELE DMMNSLSHIF HWELLVGERY GIKAAVRAER  120
RRLQEEEEEE SSRRRHLLLS AAGDSGTHHA LDALSQEGLS DEPVQHRDQT DAAGINGGGR  180
GGYWEAGQTS TKKQQHRRRK KAIATSVETD DDGNEGDDDD GMDNSNGSAL GTERQREHPF  240
IVTEPGEVAR GKKNGLDYLF HLYEQCREFL LQVQTIAKDR GEKCPTKVTN QVFRYAKKSG  300
ANYINKPKMR HYVHCYALHC LDEEASNALR KAFKEHGENV GSWRQACYKP LVDIACRHAW  360
DIDAVFNAHP RLSIWYVPTK LRQLCHLERN NAAAALVGGI SCEGSPASGR FGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1242304121186PROTEIN LEAFY
2vy2_A1e-1242304121186PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4492490.0AB449249.1 Raphanus sativus RsLFY2 mRNA for leafy-like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009150115.10.0PREDICTED: putative transcription factor BOFH isoform X2
SwissprotQ009580.0LFY_ARATH; Protein LEAFY
TrEMBLB7XD700.0B7XD70_RAPSA; Leafy-like protein
STRINGBra019619.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)